.
The Open Protein Structure Annotation Network
PDB Keyword
.

424722

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 424722
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS73966, Molecular Weight 39879.66 Da.
    Residues 351 Isoelectric Point 5.67
    Sequence lkleamsqviqampsdltissaiqnihsaskglplnhaalpptdydrspfvtspismtmpphgslqgyq tyghfpsraikseypdpytsspesimgysymdsyqtsspasiphlilellkcepdepqvqakimaylqq eqanrskheklstfglmckmadqtlfsivewarssiffrelkvddqmkllqncwsellildhiyrqvvh gkegsiflvtgqqvdysiiasqagatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlen fqlvegvqeqvnaalldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliem lhakra
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch