.
The Open Protein Structure Annotation Network
PDB Keyword
.

429232

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 429232
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS77821,SGT82680 Molecular Weight 10158.23 Da.
    Residues 84 Isoelectric Point 10.51
    Sequence ssknkphvkrpmnafmvwaqaarrkladqyphlhnaelsktlgklwrllnesekrpfveeaerlrvqhk kdhpdykyqprrrks
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch