The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 429611
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS94029,BC011707 Molecular Weight 9638.57 Da.
    Residues 83 Isoelectric Point 9.51
    Sequence megplnlahqqsrradrllaagkyeeaischkkaaaylseamkltqseqahlslelqrdshmkqllliq erwkraqreerlka
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Crystal structure of MIT domain of NRBF-2, NMR structure was deposited by RIKEN decade ago.

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch