.
The Open Protein Structure Annotation Network
PDB Keyword
.

430406

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG Biology Target:
    Status Diffraction-quality Crystals
    Target Id 430406
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS83692,BC006226 Molecular Weight 6736.58 Da.
    Residues 57 Isoelectric Point 11.45
    Sequence rkprtiyssfqlaalqrrfqktqylalperaelaaslgltqtqvkiwfqnkrskikk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch