The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative peptidase (BF3526) from Bacteroides fragilis NCTC 9343 at 2.17 A resolution. To be published
    Site JCSG
    PDB Id 4df9 Target Id 393185
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS24839,YP_213128.1, 332456 Molecular Weight 46035.55 Da.
    Residues 408 Isoelectric Point 5.80
    Sequence aqnfsdyftnktlridylftgnadkqsicldelselpvwagrrhhlselplegngqivmrdvasgkviy ttsfsslfqewletdeakevtkgfentyllpypikpaeveitlrnnkrevsanlkhvvkpddilihkkg lthitphkyllksgneeqcidvailaegyttsemetfykdaaiacealfshepfqsmknrfnivavasp sadsgvsapkqgawkhtafgshfdtfysdrylttsrvkaindalagipyehiiilanteqyggggiyna ftlttahhpnfrpvvvhefghsfggladeyfydedvmnglyplniepweqnittrinfaskwedmltkt tpvptpvadkakypigvyegggysakgiyrpafdcrmrtneyptfcpvcqraiqriiefytgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.17 Rfree 0.1878
    Matthews' coefficent 2.82 Rfactor 0.1561
    Waters 1950 Solvent Content 56.44

    Ligand Information



    Protein Summary

    Highly similar to another jcsg structure 3p1v (seq id >80).

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch