.
The Open Protein Structure Annotation Network
PDB Keyword
.

4dnl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a C2 domain of a protein kinase C alpha (PRKCA) from Homo sapiens at 1.90 A resolution. To be published
    Site JCSG Biology Target:
    PDB Id 4dnl Target Id 422958
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS67094,NM_002737 Molecular Weight 16184.61 Da.
    Residues 139 Isoelectric Point 8.75
    Sequence htekrgriylkaevadeklhvtvrdaknlipmdpnglsdpyvklklipdpkneskqktktirstlnpqw nesftfklkpsdkdrrlsveiwdwdrttrndfmgslsfgvselmkmpasgwykllnqeegeyynvpipeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.2303
    Matthews' coefficent 2.62 Rfactor 0.1862
    Waters 55 Solvent Content 53.07

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch