.
The Open Protein Structure Annotation Network
PDB Keyword
.

4e6e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative cell division protein FtsZ (Tfu_1113) from Thermobifida fusca YX-ER1 at 2.22 A resolution (PSI Community Target, van Wezel G.P.). To be Published
    Site JCSG
    PDB Id 4e6e Target Id 423184
    Molecular Characteristics
    Source Thermobifida fusca yx
    Alias Ids TPS66907,TFUS_04MAR05_CONTIG93_REVISED_GENE2109, 75 Molecular Weight 31841.23 Da.
    Residues 313 Isoelectric Point 4.41
    Sequence vaapqnylavikvvgiggggvnavnrmieeglkgvefiaintdaqallmsdadvkldvgreltrglgag anpdvgrkaaedhreeieevlkgadmvfvtagegggtgtggapvvaniarslgaltigvvtrpfsfegk rratqaeagiamlreevdtlivipndrllsisdrqvsvldafkaadqvllsgvqgitdlittpglinld fadvksvmsgagsalmgigsargddravaaaemaissplleasidgahgvllsiqggsdlglfeineaa qlvansaaaeaniifgaviddalgdevrvtviaagfd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.12 Rfree 0.2307
    Matthews' coefficent 2.69 Rfactor 0.1946
    Waters 139 Solvent Content 54.21

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch