.
The Open Protein Structure Annotation Network
PDB Keyword
.

4e6r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Cytoplasmic protein NCK2 (NCK2) from Homo sapiens at 2.20 A resolution. To be published
    Site JCSG Biology Target:
    PDB Id 4e6r Target Id 422527
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS67020,BC007195 Molecular Weight 6560.06 Da.
    Residues 57 Isoelectric Point 4.73
    Sequence ipafvkfayvaeredelslvkgsrvtvmekcsdgwwrgsyngqigwfpsnyvleevd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.2269
    Matthews' coefficent 4.27 Rfactor 0.2012
    Waters 34 Solvent Content 71.16

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch