.
The Open Protein Structure Annotation Network
PDB Keyword
.

4ecf

    Title Crystal structure of an ABC-type phosphate transport system, periplasmic component (LVIS_0633) from Lactobacillus brevis ATCC 367 at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 4ecf Target Id 418682
    Molecular Characteristics
    Source Lactobacillus brevis atcc 367
    Alias Ids TPS73674,YP_794809.1 Molecular Weight 28003.05 Da.
    Residues 263 Isoelectric Point 8.16
    Sequence agesitavgstalqplveaageqytgehlgtfinvqgggtgtglsqiqegavqignsdlfageqkgina rqlvdhrvavvgitpivnkkvgvknlstnqlikiftgqitnwkevggadqsivlinraqgsgtratfeq fglanhrsktaqeqdssgmvrsivattpgaisyvafsyvnktvqalslnhvaptevnvttndwriwsye hlytkghptgltkafityvqspaiqntlvrqlgylspdqmlverdanghitktgga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.1959
    Matthews' coefficent 2.50 Rfactor 0.1622
    Waters 317 Solvent Content 50.84

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    The protein YP_794809.1 is annotated as ABC-type phosphate transport system, periplasmic component and belongs to PFAM PF12849.

     

    The monomer structure, along with a bound phosphate, is shown below.

    SP18772A.png

     

    A DALI search confirms the anootation of this protein as a Phosphate binding protein.

    Top 10 DALI Structural Homologs
     
    N PDB Z-score RMSD LALI NRES %ID Description
    1 1twy 27.3 3.4 238 249 29 Abc Transporter, Periplasmic Substrate-binding Pr
    2 1pc3 26.6 2.2 238 333 22 Phosphate-binding Protein 1
    3 1pbp 26.2 2.0 235 321 25 Phosphate-binding Protein
    4 1quj 26.1 2.0 234 321 26 Phosphate-binding Protein
    5 1qui 26.1 2.0 234 321 26 Phosphate-binding Protein
    6 1ixi 26.1 2.0 235 321 25 Phosphate-binding Protein
    7 2z22 26.0 2.0 234 321 26 Periplasmic Phosphate-binding Protein
    8 1ixh 26.0 2.1 236 321 25 Phosphate-binding Protein
    9 1a54 26.0 2.0 235 321 26 Phosphate-binding Protein
    10 1a40 26.0 2.0 234 321 26 Phosphate-binding Periplasmic Protein Precursor

     

     

    A superposition of this protein (green) on 1pc3 (cyan) and 1qui (magenta) is shown below.

    SP18772A_1pc3_1qui.png

     

    And a close-up view of the phosphate binding site is shown below.

    SP18772A_1pc3_1qui_as.png

    The residues in this protein that interact with phosphate are labeled.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch