.
The Open Protein Structure Annotation Network
PDB Keyword
.

4fdw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a leucine rich hypothetical protein (BACOVA_01565) from Bacteroides ovatus ATCC 8483 at 2.05 A resolution. To be published
    Site JCSG
    PDB Id 4fdw Target Id 423563
    Molecular Characteristics
    Source Bacteroides ovatus atcc 8483
    Alias Ids TPS73712,ZP_02064596.1 Molecular Weight 44203.97 Da.
    Residues 400 Isoelectric Point 5.26
    Sequence ndeykkdspsaanpvepigasledfsieqlpaktiyalgenidltglnvtgkyddgkqrpvkvtseqis gfsssvpvdkqevtitiegkqksfsvhispvrvengvlteilkgyneiilpnsvksipkdafrnsqiak vvlneglksigdmaffnstvqeivfpstleqlkedifyycynlkkadlsktkitklpastfvyagieev llpvtlkeigsqaflktsqlktieipenvstigqeafresgittvklpngvtniasrafyycpelaevt tygstfnddpeamihpyclegcpklarfeipesirilgqgllggnrkvtqltipanvtqinfsafnntg ikevkvegttppqvfekvwygfpdditvirvpaesvekyknangwrdftnkittf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.2201
    Matthews' coefficent 2.80 Rfactor 0.1808
    Waters 260 Solvent Content 56.11

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This structure is highly homologous to another JCSG structure 423572 (~90% seq id). However, there is noticable difference in the domain orientation.

     

    Fig. 1 Structure comparison of two highly homologous LRR proteins showing domain movements (423563 is in cyan, 423572 is in gray)

    EL17507B-vsA.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     EL17507B-vsA.png
    EL17507B-in cyan A in gray
    128.89 kB20:26, 26 Apr 2012qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch