.
The Open Protein Structure Annotation Network
PDB Keyword
.

4fss

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a RAS p21 protein activator (RASA1) from Homo sapiens at 2.25 A resolution. To be published
    Site JCSG Biology Target:
    PDB Id 4fss Target Id 422693
    Related PDB Ids 2m51 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS67058,BC033015 Molecular Weight 7201.84 Da.
    Residues 61 Isoelectric Point 4.64
    Sequence rrrvrailpytkvpdtdeisflkgdmfivhneledgwmwvtnlrtdeqglivedlveevgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.25 Rfree 0.2374
    Matthews' coefficent 3.47 Rfactor 0.2133
    Waters 71 Solvent Content 64.58

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

     

    Pfam Update: As you are probably aware it hits our SH3 MODEL; SH3_1 SH3 domain Domain CL0010 5 53 5 51 1 46 44.6 5.9e-12 The sequence matches the HMM logo very clearly, though it is slightly longer. We do have a number of strucutres for this domain.

    Shown below is a ribbons representation of the structure

    monomer.png

     

    2j05_

     

    This structure is among several others in the Protein Data Bank for the human GTPase-activating domain of the p120 RAS GAP protein.

     

    Top PDB hits from FFAS includes: 2j05, 4fss, and 2qgi.

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     monomer.png
    No description
    77.96 kB16:35, 29 Feb 2012haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch