.
The Open Protein Structure Annotation Network
PDB Keyword
.

4hpe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative cell wall hydrolase (CD630_03720) from Clostridium difficile 630 at 2.38 A resolution. To be published
    Site JCSG
    PDB Id 4hpe Target Id 391770
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS7729,YP_001086839.1, PF00877, 85319 Molecular Weight 33440.51 Da.
    Residues 307 Isoelectric Point 6.18
    Sequence adsddensnfssgitgmnlsaevlkhqpmvekyarengiseyvnvllaiiqvesggtaedvmqsseslg lppnsldtessikqgckyfasllsssknqgiddlnvaiqsynygggyvgyvagkgkkhtfnlaesfare ksggkkvtytnpiavaknggwrwnygnmfyvelvnqyltvpqvsgelaqkvmnealkyqgwkyvyggsn pntsfdcsgltqwcygkagislprtaqaqydatqhlplsqakagdlvffhstynagsyvthvgiyvgnn qmyhagdpigyadlsssywqqhligagrvkq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.38 Rfree 0.2108
    Matthews' coefficent 2.77 Rfactor 0.1746
    Waters 590 Solvent Content 55.60

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    A close homolog of 4fdy.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch