.
The Open Protein Structure Annotation Network
PDB Keyword
.

4ib2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative lipoprotein (RUMGNA_00858) from Ruminococcus gnavus ATCC 29149 at 1.76 A resolution. To be published
    Site JCSG
    PDB Id 4ib2 Target Id 416853
    Molecular Characteristics
    Source Ruminococcus gnavus atcc 29149
    Alias Ids TPS45758,ZP_02040096.1, 327498 Molecular Weight 27544.00 Da.
    Residues 251 Isoelectric Point 4.42
    Sequence eekgssedaktikvaasatphaeileqaksilkkegyqlevtvfddyvqpnevvesgefdanyfqhvpy lesfneekgthlvdagdihyepfgiypgtkksldeisegdkiavpndttnearallllqdngiitlkdg aglnatvndieenpynveiveleaaqvarvtgetayvvlngnyaleagysvakdalayeksdseaakty vniiavkegnekeekiqalvkalksdeikeyiektydgavipfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.76 Rfree 0.1844
    Matthews' coefficent 2.05 Rfactor 0.1619
    Waters 351 Solvent Content 40.02

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This target is classified in Pfam family Lipoprotein_9 (PF03180), NLPA lipoprotein.

    The protein has endogenous Methionine bound at the putative active site.

    Fig1.png

    JCSG has solved several similar structures with PDB ids 4ef1, 4ef2, 4got, 3up9, etc and there are several other related structures. See TOPSAN page for 4ef1.[Ref]

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    381.28 kB23:58, 25 Oct 2012debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch