.
The Open Protein Structure Annotation Network
PDB Keyword
.

4iyk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (BACUNI_04699) from Bacteroides uniformis ATCC 8492 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 4iyk Target Id 417960
    Molecular Characteristics
    Source Bacteroides uniformis atcc 8492
    Alias Ids TPS76640,ZP_02073238.1, 332363 Molecular Weight 24898.64 Da.
    Residues 224 Isoelectric Point 5.01
    Sequence ltsceidnyegpdasihgsildeqtgelvgsdmengnaikvrehgftnatdqtwyitntgeyrnnmvfa atydvrfengnfypfevkdfvvksgdnvydfkvipyirvkspkvekngnvitatfsleagkqevklkei qlfafsdmwvgnnvkltlnggtdkqvfspstainsadiytlsidlgqnadvlkysknyyfrigaladvs gvgtvrhnyapvvvikl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2070
    Matthews' coefficent 2.54 Rfactor 0.1735
    Waters 244 Solvent Content 51.49

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    A first official structure from DUF3823 (PF12866) family, similar to JCSG structures 3hn5 (Topsan page for 3hn5 has more details, 3hn5 has 27% seq id over 60% of this target) which is still not listed in PFAM as a structure hit. Like 3hn5, consists of two domains, with  the first domain similar to prealbumin, and a C-terminus domain is a probably a new type of a greek-key-beta barrel fold.


    Members of this Pfam are all bacterial proteins, specifically, all from Bacteroidetes. These are possibly SusE-like proteins. JCSG has solved 2 other structures from this Pfam, PDB ids 4eiu (34% seq id over 65% of this target) and 4fxt (25% seq id over 80% of this target).

    Fig1.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    315.18 kB18:39, 11 Dec 2012debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch