.
The Open Protein Structure Annotation Network
PDB Keyword
.

4jqr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (BACCAC_02373) from Bacteroides caccae ATCC 43185 at 2.05 A resolution. To be published
    Site JCSG
    PDB Id 4jqr Target Id 416583
    Molecular Characteristics
    Source Bacteroides caccae atcc 43185
    Alias Ids TPS66791,ZP_01960755.1, 327290 Molecular Weight 25364.62 Da.
    Residues 228 Isoelectric Point 4.25
    Sequence dddddvknevvvsfenllteensqfiadgtpnnqafqetdfkdpknlinfnhyyadwgsgysfagfsym nitdnqtanspapitgkakigsvyigvdstdgeygtpailtildtnyklkgtwianstwaymgmiqgdg yarafkagdwykvtatgydeagnetgkaeillanyktdndlpvkewiwfdltplqnavkvkfipdssdk neygmntasyfcldgitliek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.1908
    Matthews' coefficent 3.79 Rfactor 0.1644
    Waters 259 Solvent Content 67.56

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This is a second structure from a  newly defined PFAM family PF14717 (DUF4465), the first being 4e9k (SP13250B) http://www.topsan.org/Proteins/JCSG/4e9k.

     

    Fig. 1

    sp13250a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     sp13250a.png
    sp13250a
    133.78 kB20:55, 5 Feb 2013qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch