.
The Open Protein Structure Annotation Network
PDB Keyword
.

4jx2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (lpg1979) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1 at 2.65 A resolution. To be published
    Site JCSG
    PDB Id 4jx2 Target Id 418779
    Molecular Characteristics
    Source Legionella pneumophila subsp. pneumophila str. philadelphia 1
    Alias Ids TPS76855,YP_095995.1 Molecular Weight 48187.20 Da.
    Residues 430 Isoelectric Point 8.80
    Sequence htnntnnkglsasinngvgssssnntyvtpqafwnlyfdftgdetpgypkgkinisqtlfqsemkknss laqqnegqlilfinstlyiynsdrqlklkqlmrtapnsgftemtaishigpalmylakikengdaswks qmenllkdiqavkvinaqtpnnwleqvnapawkphlttihnmidyacsmagnymsdvlneklsfdmasl qndflngnktypipynnvmigtfmltalqsmdqlhskisqlkidwphakviirfvagsnvsagvskgsn wlvpfvqalsnnklatdriyitpyaavkpslgaqeltqadynyynntvwgarhnrriianevftnitsi flpdrpaipgdytyskppkiedflmrlkfslaeptemlsntvgfwmagelaeknwnynkisipgittgf pegistypnnnpviqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.65 Rfree 0.2014
    Matthews' coefficent 2.89 Rfactor 0.1622
    Waters 257 Solvent Content 57.39

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Interesting protein - unnanotated, hypothetical protein lpg1979.  Essentially an ORFan - very close homologs present in several Legionella species, more distant ones in some proteobacteroa (Chelativorans sp. BNC1 and Acidovorax sp. CF316) and, interestingly in Trichoderma virens - a fungi! No PFAM, no hits to anything in FFAS etc.

    In Legionella pneumophila lpg1979 is part of an operon with three other uncharacterized proteins and with a protein (lpg1978) annotated as teichoic acid biosynthesis protein. I'm not sure of the origin on this annotation. All I can say about this protein (lpg1978) is that is has a glycosyltransferase sugar-binding domain on the N-terminus.
     
    The protein is expected to function as a dimer. The N-helix appears to be swapped within the dimer.
     
     
    Fig. 1 monomer
    sp19248a-monomer.png
    Fig. 2 dimer
    sp19248a.png
     
    Structural similarity searches dont find any significant similarities if the entire structure is used for searching, but this changes if you can separate the structure into two (not-continuous domains):
     
    the alpha/beta (residues 100-128 & 260-353) - has a clear ribonuclease-H-like fold (3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest):
    SP19248Acore.png

    green - core a/b domain of lpg1979, red - Tex RuvX-like domain from the  Tex protein from Pseudomonas aeruginosa (PDB code 3bkzA). The helical domain (residues 129-260 & 353- C-term) consists of three helical haripins stacked on top of each other (the last one a bit to the side).

    SP19248Ahelical domain.png

    the first three helices are very similar to a spectrin repeat (read on the picture below)

    SP19248Ahelicaldomain_spectrin.png

     

    but I wouldnt read too much from this, its just a helical bundle.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch