.
The Open Protein Structure Annotation Network
PDB Keyword
.

4k4k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative cell adhesion protein (BACUNI_00621) from Bacteroides uniformis ATCC 8492 at 1.67 A resolution. To be published
    Site JCSG
    PDB Id 4k4k Target Id 417954
    Molecular Characteristics
    Source Bacteroides uniformis atcc 8492
    Alias Ids TPS78269,ZP_02069216.1, 332306 Molecular Weight 29531.02 Da.
    Residues 281 Isoelectric Point 4.65
    Sequence gentpqptdgrvaleatsgirmntraydktweagdaigiymlngdatdgngnrkyttaqtaengsftaa egqtiyfpvdasqrdfvayypyretladgnvytvdvsvqtpqkdidlmgaakvegkdktdpkvafvfth klvklditikadgtsltdadlagttvsisnqqtaatynvvtggdatvttgttkeivlhtdglkaegivl paastagmaltftvpglegqafhwdvnsaaqskafvagskylytitiskagvevsskvedwtpgnggge tgnae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.67 Rfree 0.2166
    Matthews' coefficent 1.87 Rfactor 0.1866
    Waters 475 Solvent Content 34.13

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This protein is a member of DUF3988, this is 15th structure of  these proteins from JCSG, see tag for details.

     

    Fig. 1

    sp16878a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     sp16878a.png
    sp16878a.png
    102 kB17:28, 3 Apr 2013qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch