.
The Open Protein Structure Annotation Network
PDB Keyword
.

4kh9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (lpg0956) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 4kh9 Target Id 418834
    Molecular Characteristics
    Source Legionella pneumophila subsp. pneumophila str. philadelphia 1
    Alias Ids TPS73682,YP_094990.1 Molecular Weight 42384.79 Da.
    Residues 373 Isoelectric Point 6.74
    Sequence ftlprqptkayecencsqlsrenlhdkweitneplnnnisnvrrsygykerisleqlqrgviistlapg avvritplqnksipelliktpknqllplkeasslynqddevgnnplaitkhqamlqikpelgygkfilk skditnkyadaymisvldkfsitylevetdslhyqygdklkatislhnditeydvndvdarlvgpkgqv islnltklksnvfegtatldselndrgenwyletdvqteygqeiirrsghtafsysipsaslmnvkkls skpltfvvtvdvatasryalqsvlfqkngkgearpiqtsqraqwlepgkhvlqftfdnhnqlsddnlyl gylrlidygqlktvyqynqpvklsqlvd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2207
    Matthews' coefficent 2.32 Rfactor 0.1937
    Waters 242 Solvent Content 47.08

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Legionella pneumophila lpg0956 protein is a first representative of a newly defined DUF4785 (PF16024) Pfam family. Function of this protein is uknown. Structure constists of three beta barrel domains, the first with a jelly-roll fold and the other two with Ig-like folds. A long N-terminal peptide interacts with all three domains.

     

    Fig. 1

    sp19432a.png

     

    ALignment of the first, N-terminal domain of lpg0956 (red) with the C-terminal domain of Bacillus alkaline serine protease (PDB:1wmd, green), which has  Galactose-binding domain-like beta sandwich jelly-roll fold. The alignment (FATCAT) has an RMSD of 3.05 Å over 90 aminoacids.

     

    SP19432A_1wmd.png

    ALignment of the second, central domain of lpg0956 (red) with filamin repeat (rod domain) of F-actin cross-linking gelation factor from Dictyostelium discoideum (PDB:1qfh, green), which has an mmunoglobulin-like beta-sandwich fold The alignment (FATCAT) has an RMSD of 3 Å over 93 aminoacids.

    SP19432A_1qfh.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch