.
The Open Protein Structure Annotation Network
PDB Keyword
.

4l1n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative conserved lipoprotein (NT01CX_1156) from Clostridium novyi NT at 2.70 A resolution. To be published
    Site JCSG
    PDB Id 4l1n Target Id 418140
    Molecular Characteristics
    Source Clostridium novyi nt
    Alias Ids TPS73662,YP_877239.1, 323007 Molecular Weight 23406.22 Da.
    Residues 205 Isoelectric Point 8.38
    Sequence evnkkdvkietntnkkdsekenvnntqenvsvekqsakkakvkednskkmflkkelgknskptfatkwk nssnnkfsaciegkgenaleegvgkiyiknlkeqskweldldqdqqkntpkyidwfddnnlmvvisrah gtvsqggilykvnietgqatelyntkdnkkqvvyavkkgdkidvqilvyedddllesheetktitvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.2006
    Matthews' coefficent 5.54 Rfactor 0.1976
    Waters 10 Solvent Content 77.79

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    A narrowly distributed protein with only a few closely related homologs, function is unknown. There are weak seq homology between this proteins and a number of eukaryotic proteins, presumably due to beta-propeller sequence repeat.

     

    The structure is rather unique in that it contains an incomplete beta-propeller. The fold consists of three blades with 5, 4 ad 3 strands respectively. In other words, the first blade has one extra strand and the last blade lacks one strand, compared to classic 4-stranded blade.

     

    This may represent the first observation of 3-bladed open-ended "beta-propeller".

     

     

     

    Fig. 1

    sp18005a.png

    It may represent the first structure of DUF4652, the top FFAS hit. DUF4652 is restricted to bacteria, and so may linked to bacteria-specifc functions.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     sp18005a.png
    sp18005a
    107.28 kB02:49, 4 Oct 2012qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch