.
The Open Protein Structure Annotation Network
PDB Keyword
.

4l7a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (BACCAC_01431) from Bacteroides caccae ATCC 43185 at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 4l7a Target Id 419032
    Molecular Characteristics
    Source Bacteroides caccae atcc 43185
    Alias Ids TPS73686,ZP_01959821.1 Molecular Weight 31280.85 Da.
    Residues 270 Isoelectric Point 5.14
    Sequence cqdddledqsifdasekeksefdrwllenyvnpynidfkyrmehiesdythnlvptdfwlsvklakivk hcwleaydevggldftracapkvihligsaswdkgtytlgtaegglkvtlymgnwldltnvdrmneyyf kvmhhefahilhqkknypvdydkisagnytptgwqnrklaevaplgfvtpyagskpsediaevtacflt ypeaqwenvmtlagekgkpiidqklamvkkymkdswqvdldllrkviarrtneiseldldhiy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.09 Rfree 0.2341
    Matthews' coefficent 2.43 Rfactor 0.2025
    Waters 332 Solvent Content 49.40

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This protein is a putative metallopeptidase containing a HEXXH motif. The genomic context suggests it may be involved in PUL related activities. No Zinc was present since EDTA was added to crystallization conditions.

    The is weak sequence similarity between this protein and anthrax lethal factor and MtfA.

     

    Fig. 1 HExxE motif (sticks)

    sp15690a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     sp15690a.png
    sp15690a
    182.55 kB15:50, 30 May 2013qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch