.
The Open Protein Structure Annotation Network
PDB Keyword
.

4l8j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative efflux transporter (BACEGG_01895) from Bacteroides eggerthii DSM 20697 at 2.06 A resolution. To be published
    Site JCSG
    PDB Id 4l8j Target Id 417716
    Molecular Characteristics
    Source Bacteroides eggerthii dsm 20697
    Alias Ids TPS75034,ZP_03459111.1, 324704 Molecular Weight 36505.77 Da.
    Residues 327 Isoelectric Point 7.91
    Sequence edtalvrpvktatvssqsvilkdfsgmveaveyvklafrvsgqiinlpvvegqrvkkgqliaaidprdi slqyaadkaayetaaaqvernkrllgrqaislqeyeisvanyqkaksayelstnnmrdtkllapfdgsi etrlvenyqrvnsgegivrlvntrklrikftvpddylyllrakdatfkvefdtykgtvfnarleeyldi stdgtgipvtiiiddaafdrtiydvkpgftcnirlasdiapfieeklmnvplsavfgdsenkntyvwiv kdnkvnrrevtvysptgeanlliskglkpgetvvtagvyqlvegqrikevk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.06 Rfree 0.2344
    Matthews' coefficent 3.09 Rfactor 0.2080
    Waters 174 Solvent Content 60.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Target id 417716 belongs to the Hly_D2 (PF12700) Pfam family. This includes several secretion proteins with several structural representatives in the PDB. Shown below is a ribbons representation of the structure of the monomer of target id 417716

     

    monomer.png

    The structure consists of three sub-domains with the N-terminal sequence region forming structural elements in all three domains. A DALI search of the PDB shows target id 417716 to have structural similarity to the following related targets

    PDB ID DALI Z-Score rmsd (Ang) length of alignment number of aligned residues %sequence id Description
    1vf7 16.6 2.9 220 237 24 Crystal structure of the membrane fusion protein, MexA of the multidrug transporter [Ref]
    2f1m 15.0 3.9 214 247 21 Conformational flexibility in the multidrug efflux system protein AcrA[Ref]
    3fpp 13.8 5.5 224 266 18 Crystal structure of E.coli MacA [Ref]

     

    Shown below is a comparison of the structures of target id 417716 (green) and the top scoring DALI hit, PDB ID 1vf7

     

     

     

    1vf7_onto_SP5709A.png

    This comparison shows that target id 417716 contains an extra domain. PISA predicts target id 417716 to be a dimer with the dimer interface occuring along this extra domain.

     

     

     

     

     

     

     

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    3. (No Results)

       


      Discuss this publication
    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch