.
The Open Protein Structure Annotation Network
PDB Keyword
.

4l8n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a PDZ domain protein (BDI_1242) from Parabacteroides distasonis ATCC 8503 at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 4l8n Target Id 394759
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS25840,YP_001302625.1 Molecular Weight 52299.56 Da.
    Residues 456 Isoelectric Point 6.02
    Sequence aqnrntsicrlgftydisqsknwgnnkpviksiipyssaeqagikkydvieeingvpvtevsvdeipql lnpagrndvlltisnlsspskqvlvkkdckksnaitedqlasayamyslettneqefvcpfkttvtsdg vdfgnfktfafstidennrkletvinecieneltkkgltvdiakpdlliqtfyffdknpnylgankvlv ekeptyrynfshskmekfpflnyaaaeaeaeyllqfgiriidqkdipgrvlweceanelledsyrldey arvhvplmcmqypytkygrnvpfkvskktynytgisydidkldqvvdvdrnspayaagirprdiiekig rhkmdhsaeefssaykrfitntmqyrdpktmftdangfkycmfwdvfkypqiadasqssdylpafsyly yfapyinpsgnnactfnikrgktkleviirptirsevtveik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.2195
    Matthews' coefficent 2.85 Rfactor 0.1863
    Waters 99 Solvent Content 56.87

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    A hypothetical protein consists of three domains: N-terminal and C-terminal PDZ domains, and a middle DUF4136 domain.

    The overall shape of the molecule is similar to DegP, which instead contains a protease and two N-terminal PDZ domains. This protein does not contain a protease domain, but an DUF4136 domain. Based on the domain organization, we speculate that this protein may be a periplasmic chaperone involved in a secretion process.

     

    Fig. 1

     


    gs13649a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     gs13649a.png
    gs13649a
    141.68 kB18:42, 28 May 2013qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch