.
The Open Protein Structure Annotation Network
PDB Keyword
.

4lb8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (BT3222) from Bacteroides thetaiotaomicron VPI-5482 at 2.49 A resolution. To be published
    Site JCSG
    PDB Id 4lb8 Target Id 386369
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS77974,NP_812134.1, 323162 Molecular Weight 32664.19 Da.
    Residues 289 Isoelectric Point 5.42
    Sequence ndeqevnmvkptnanseievindgtmikfkdvesyenallkvsamstseqvsflnslsfksqmilmqea dgeldkicnqaadkaefdvlyekykhkygdvfmfntidatdlspysrlvyvaneyfvnmkgefmigdsl vvdkvytdfkerqqqftvstrssvsdlssineaysrqkdrkvglylsvssgiihanftsqkkgvfgwsr ysttyhakvnlrgfefaqgellgygpvyvnkdgipfaidtkemggnvtkvfgrklaqectgtieiwsrg vpydqrgfatvrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.49 Rfree 0.2282
    Matthews' coefficent 3.06 Rfactor 0.1804
    Waters 80 Solvent Content 59.80

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This target has Uniprot id Q8A2T3 and is a founding member of a new Pfam family DUF4848  (PF16140). FFAS does not significant hits to other proteins.

     

    Fig1.png

    The predicted biological assembly is a dimer, which is very interesting in appearance formed by the close interlocking of 2 monomers:

    dimer.png

    The monomer can be split into 2 domains including residues 38-166 (N-term) and 183-310 (C-term) joined by the long linker.

    EBI-SSM does not find any significant hits with other structures using the N-term portion. The C-term portion does have similarities to some other Ig-like beta-sandwich proteins, e.g., the top SSM hits are with PDB id 3d33 (DUF3244 family protein), 3uc2, which are both JCSG structures. Other hits are with 2vpv (MIF2P dimerization domain), etc.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     dimer.png
    No description
    406.29 kB23:05, 11 Jun 2013debanuActions
     Fig1.png
    No description
    255.72 kB00:41, 14 May 2013debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch