.
The Open Protein Structure Annotation Network
PDB Keyword
.

4lba

    Title Crystal structure of a conjugative transposon lipoprotein (BACEGG_03088) from Bacteroides eggerthii DSM 20697 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 4lba Target Id 417670
    Molecular Characteristics
    Source Bacteroides eggerthii dsm 20697
    Alias Ids TPS76581,ZP_03460274.1, 324702 Molecular Weight 15744.81 Da.
    Residues 136 Isoelectric Point 4.36
    Sequence cdddmdiqqsypftvevmpvpnkvvkgqtveircelkkegdfsgtlytiryfqfegegslkmdngitfl pndryllenekfrlyytaagdeahnfivvvednfsnsyelefdfnnrnvkdddltivpignfspllk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.1873
    Matthews' coefficent 2.87 Rfactor 0.1651
    Waters 249 Solvent Content 57.10

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein ZP_03460274.1 is annotated as hypothetical protein BACEGG_03088.

    The sequence appears to belong to DUF3872, PF12988. There are already two NMR structures for this family, 2L7Q and 2L3B a conjugative transposon lipoprotein. This is the first crystal structure in this family.
     

    The monomer structure is shown below in rainbow representation.

    SP14019C.png

    Top 10 DALI Structural Homologs
     
    N PDB Z-score RMSD LALI NRES %ID Description
    1 2l3b 14.6 1.6 101 130 49 Conserved Protein Found in Conjugate Transposon
    2 2l7q 13.8 2.0 101 124 51 Conserved Protein Found in Conjugate Transposon
    3 4fxk 9.7 2.3 92 697 12 Complement C4 Beta Chain
    4 4fxg 9.3 2.3 91 740 12 Complement C4 Beta Chain
    5 3cu7 8.8 2.5 89 1625 12 Complement C5
    6 3qs3 8.7 2.2 96 176 8 Fimbrillin Matb Homolog, Ecpd
    7 3hrz 8.7 2.4 90 233 14 Cobra Venom Factor
    8 2xwj 8.7 2.5 90 901 12 Complement C3 Beta Chain
    9 4d94 8.6 2.5 91 1274 12 Thioester-containing Protein 1
    10 3pvm 8.6 2.5 91 1627 12 Complement C5

     

    Superposition of 2l3b (magenta) on BACEGG_03088 (green) is shown below.

    SP14019C_2l3b.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     SP14019C.png
    No description
    53.98 kB18:50, 31 May 2013abhinavkActions
     SP14019C_2l3b.png
    No description
    67.33 kB18:50, 31 May 2013abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch