.
The Open Protein Structure Annotation Network
PDB Keyword
.

4leh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a bile-acid 7-alpha dehydratase (CLOSCI_03134) from Clostridium scindens ATCC 35704 at 2.90 A resolution. To be published
    Site JCSG
    PDB Id 4leh Target Id 423443
    Molecular Characteristics
    Source Clostridium scindens atcc 35704
    Alias Ids TPS64885,ZP_02432876.1, 3.10.450.50 Molecular Weight 19531.40 Da.
    Residues 166 Isoelectric Point 5.43
    Sequence mtleervealekelqkmkdieaikelkgkyfrcldgkmwdelettlspnivtsysngklvfhspkevtd ylkstmpkeeismhmghtpeitidsettatgrwyledkliftdgkykdvginggafytdkyekiegqwy iletgyvriyeehfmrdpkihitmnmhk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.90 Rfree 0.2174
    Matthews' coefficent 3.04 Rfactor 0.1773
    Waters 3 Solvent Content 63.75

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch