.
The Open Protein Structure Annotation Network
PDB Keyword
.

4ler

    Title Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (BVU_1254) from Bacteroides vulgatus ATCC 8482 at 1.42 A resolution. To be published
    Site JCSG
    PDB Id 4ler Target Id 385643
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS79054,YP_001298566.1, BIG_773 Molecular Weight 52695.79 Da.
    Residues 468 Isoelectric Point 4.60
    Sequence emnvdpnnatttnpsllltgvaysafnqtssdachaakmliltsgeskyqvykwtrgdfdyysnlrdvt kmseeagegsayqalahffranyfyqltldfgsipytdalkaetdanyqpaydsqevvlagilkeleea dkmlegsdeiisgdiiyngnlvnwrklinayrlrilmslsgkekvgdidvksefskivadgplmeslsd ngqliyldqqdnrypyfndsdfgsgrfmdstyiaelatrqdprlfavatqtpnaekagkaindfssydg gdpavpyslvndkavagncskpapryyqtptnepmvllgyveqqlilaeavvrgwiqgddkiyyesavk asfefyqkyavsvadyltqdaaaeylrndkvayssslstdekieriimqkylptflqgsvwlpyyealr tgypdfrraagvslpyrwmypqdeynnnathveaalneqfggsdktsdkpwwlq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.42 Rfree 0.1684
    Matthews' coefficent 2.18 Rfactor 0.1433
    Waters 565 Solvent Content 43.70

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein YP_001298566.1 is annotated as putative outer membrane protein, probably involved in nutrient binding.

     

    Monomer structure, a SusD homolog,  is shown below.

     

    GS7807N.png

     

     

     

    Top 10 DALI Structural Homologs
     
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 3ejn 56.5 1.2 445 450 55 Susd Homolog
    2 3mx3 47.5 2.2 449 470 34 Susd Homolog
    3 3gzs 35.2 2.5 409 495 24 Uncharacterized Susd Superfamily Protein
    4 3sgh 34.9 2.7 411 484 24 Susd Homolog
    5 4f53 34.7 2.7 412 498 24 Susd Homolog
    6 3cgh 33.9 2.7 417 507 21 Susd Homolog
    7 3fdh 33.1 3.4 415 472 19 Susd Homolog
    8 4f7a 32.5 2.8 411 498 21 Putative Uncharacterized Protein
    9 3p1u 32.2 2.9 416 515 19 Susd Homolog
    10 3ehm 32.2 2.9 410 510 24 Susd Homolog

     

    A superposition of YP_001298566.1 (green) on 2ejn (magenta) is shown below.

    GS7807N_3ejn.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     GS7807N.png
    No description
    205.16 kB17:24, 6 Jun 2013abhinavkActions
     GS7807N_3ejn.png
    No description
    283.8 kB17:24, 6 Jun 2013abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch