.
The Open Protein Structure Annotation Network
PDB Keyword
.

4lii

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an apoptosis-inducing factor, mitochondrion-associated, 1 (AIFM1) from Homo sapiens at 1.88 A resolution. To be published
    Site JCSG Biology Target:
    PDB Id 4lii Target Id 422903
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS73464,BC111065 Molecular Weight 55709.56 Da.
    Residues 512 Isoelectric Point 7.68
    Sequence sglgltpeqkqkkaalsasegeevpqdkapshvpflligggtaafaaarsirardpgarvlivsedpel pymrpplskelwfsddpnvtktlrfkqwngkersiyfqppsfyvsaqdlphienggvavltgkkvvqld vrdnmvklndgsqityekcliatggtprslsaidragaevksrttlfrkigdfrslekisrevksitii gggflgselacalgrkaralgteviqlfpekgnmgkilpeylsnwtmekvrregvkvmpnaivqsvgvs sgklliklkdgrkvetdhivaavglepnvelaktggleidsdfggfrvnaelqarsniwvagdaacfyd iklgrrrvehhdhavvsgrlagenmtgaakpywhqsmfwsdlgpdvgyeaiglvdsslptvgvfakata qdnpksateqsgtgirseseteseaseitippstpavpqapvqgedygkgvifylrdkvvvgivlwnif nrmpiarkiikdgeqhedlnevaklfnih
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.88 Rfree 0.2112
    Matthews' coefficent 2.44 Rfactor 0.1667
    Waters 311 Solvent Content 49.58

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    This is the same as a previously solved Apoptosis Inducing Factor (AIF), PDB 1M6I.

     

    CLUSTAL format alignment by MAFFT (v7.051b)
    
    
    1M6I_A          EEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
    4lii            ------------------------------------------------PYMRPPLSKELW
                                                                    ************
    
    1M6I_A          FSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRD
    4lii            FSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRD
                    ************************************************************
    
    1M6I_A          NMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREV
    4lii            NMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREV
                    ************************************************************
    
    1M6I_A          KSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREG
    4lii            KSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREG
                    ************************************************************
    
    1M6I_A          VKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG
    4lii            VKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG
                    ************************************************************
    
    1M6I_A          FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS
    4lii            FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS
                    ************************************************************
    
    1M6I_A          MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASE
    4lii            MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASE
                    ************************************************************
    
    1M6I_A          ITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHED
    4lii            ITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHED
                    ************************************************************
    
    1M6I_A          LNEVAKLFNIHED
    4lii            LNEVAKLFNIH--
                    ***********  
    

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch