.
The Open Protein Structure Annotation Network
PDB Keyword
.

4lir

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a nucleoporin 35kDa (NUP35) from Homo sapiens at 2.46 A resolution. To be published
    Site JCSG Biology Target:
    PDB Id 4lir Target Id 422743
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS72322,BC047029 Molecular Weight 12877.89 Da.
    Residues 116 Isoelectric Point 6.24
    Sequence spaqldpfytqgdsltsedhlddswvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqskl qarkalskdgrifgesimigvkpcidksvmessdrcalsspslaftp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.46 Rfree 0.2058
    Matthews' coefficent 2.19 Rfactor 0.1908
    Waters 12 Solvent Content 43.90

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch