.
The Open Protein Structure Annotation Network
PDB Keyword
.

4ljx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an AT-rich interactive domain-containing protein 3A (ARID3A) from Homo sapiens at 2.21 A resolution. To be published
    Site JCSG Biology Target:
    PDB Id 4ljx Target Id 421838
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS72282,BC060828 Molecular Weight 15992.51 Da.
    Residues 136 Isoelectric Point 6.82
    Sequence qppdhgdwtyeeqfkqlyeldgdpkrkeflddlfsfmqkrgtpvnripimakqvldlfmlyvlvtekgg lvevinkklwreitkglnlptsitsaaftlrtqymeylypyecekrglsnpnelqaaidsnrregrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.21 Rfree 0.2017
    Matthews' coefficent 1.95 Rfactor 0.1822
    Waters 55 Solvent Content 36.77

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Xray structure of a previously solved NMR structure, 2kk0.

     

    Fig.1 X-ray (green), NMR (red)

    RG20614A.ARID3A.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     RG20614A.ARID3A.png
    RG20614A.ARID3A
    144.48 kB19:33, 3 Apr 2013qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch