.
The Open Protein Structure Annotation Network
PDB Keyword
.

4lqx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a TENA/THI-4 domain-containing protein (SSO2700) from Sulfolobus solfataricus P2 at 2.34 A resolution. To be published
    Site JCSG
    PDB Id 4lqx Target Id 394448
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS29521,NP_344022.1, _0093.002246_, 326358 Molecular Weight 35198.82 Da.
    Residues 303 Isoelectric Point 5.97
    Sequence mplcpscemkfnswedlakhmdliantnsdkshvmwlnrnismkrmevnelanalerffstpnslsmwi rtrfierfygdnphpfivamqnptkgvllgyviehqhflknwvkvlssivfktdkddvlqyelenisve figyngrpahyelllrmgealgmprekilstqplpstqsaiktwrkiaesktwletmasmhslelvadr slvkygaklpyfnpeilssdeypqavkdflregyeadvshagealemvekyteememkeqvqitvlksf dafskyllarlergfeiepsllkrvik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.34 Rfree 0.2163
    Matthews' coefficent 2.56 Rfactor 0.1719
    Waters 317 Solvent Content 51.86

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    This structure from archaea contains two domains, n-terminal prokaryotic zinc finger (ZF) and c-term TENA_THI-4 domain (Pfam; PF03070). The zinc finger domain is rare in prokaryotes. The TENA_THI-4 domain has a nitro-bezene like compound in the active site.

     

    The overall structure arrangement is reminiscent of a transcription regulator, with the ZF domain binds RNA while TENA_THI-4 domain serves as ligand binding domain. It remains unclear whether the ZF can really bind DNA in this case.

     

    Fig. 1 dimer (zinc and NBZ in red)

    mh11107a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     mh11107a.png
    mh11107a
    203.81 kB15:48, 3 Jul 2013qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch