.
The Open Protein Structure Annotation Network
PDB Keyword
.

4lqz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (SAV1798) from Staphylococcus aureus subsp. aureus Mu50 at 1.92 A resolution. To be published
    Site JCSG
    PDB Id 4lqz Target Id 417490
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mu50
    Alias Ids TPS79927,NP_372322.1, 328125 Molecular Weight 14984.31 Da.
    Residues 127 Isoelectric Point 7.08
    Sequence qrfeiqqhnetigsiyfsadyahirgiekgtakyfidkvgskrylfieyipdnvlnckpdfwktlkykk dkvtyyvylienlddevfhlsalqdmnripidiaddvatmgksphqndrmtlklnknn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.92 Rfree 0.2360
    Matthews' coefficent 1.94 Rfactor 0.1946
    Waters 82 Solvent Content 36.75

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The close/identical homologs are only present in S aureus.

     

    The structure reveals similarity to pilot proteins such MxiM and HslJ.

     

        No:  Chain   Z    rmsd lali nres  %id PDB  Description
       1:  4gzv-H  7.3  3.2   90   130    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
       2:  4i95-A  7.2  4.2   94   137   10 PDB  MOLECULE: PUTATIVE UNCHARACTERIZED PROTEIN;                          
       3:  4gzv-C  7.2  4.5   94   136    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
       4:  4iab-B  7.2  4.2   93   136   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
       5:  4i95-B  7.2  4.3   94   137   10 PDB  MOLECULE: PUTATIVE UNCHARACTERIZED PROTEIN;                          
       6:  4gzv-B  7.2  4.0   92   133    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
       7:  4gzv-F  7.1  3.5   89   136    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
       8:  4iab-C  7.1  4.4   93   136   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
       9:  4gzv-G  7.1  4.4   93   136    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
      10:  4gzv-D  7.1  4.2   92   133    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
      11:  4gzv-E  7.0  3.2   90   141    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
      12:  4iab-A  6.9  4.2   93   142   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
      13:  4iab-D  6.9  4.2   92   133   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
      14:  4gzv-A  6.8  4.2   92   139    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN;                                      
      15:  2kts-A  6.4  2.9   88   117   11 PDB  MOLECULE: HEAT SHOCK PROTEIN HSLJ;                                   
      16:  1y9t-A  6.3  3.0   86   110    7 PDB  MOLECULE: LIPOPROTEIN MXIM;                                          
      17:  2aco-A  6.2  2.8   84   168   11 PDB  MOLECULE: OUTER MEMBRANE LIPOPROTEIN BLC;                            
      18:  1y9l-A  6.2  3.1   86   110    7 PDB  MOLECULE: LIPOPROTEIN MXIM;                                          
      19:  3kq0-A  6.0  2.5   83   175    7 PDB  MOLECULE: ALPHA-1-ACID GLYCOPROTEIN 1;                               
      20:  1bbp-B  6.0  3.5   90   173    4 PDB  MOLECULE: BILIN BINDING PROTEIN;                                     
      21:  3hty-C  6.0  2.6   74    93    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN BT_0869;                              
      22:  1yiv-A  5.9  2.9   78   131    4 PDB  MOLECULE: MYELIN P2 PROTEIN;                                         
      23:  1lke-A  5.9  2.9   88   157    6 PDB  MOLECULE: DIGA16;                                                    
      24:  1pmp-B  5.9  2.9   79   131    4 PDB  MOLECULE: P2 MYELIN PROTEIN;    

     

    Pfam note:

    I have built it as PF16253 DUF4909. Members have a typicla prokaryotic
    lipoprotein attachment site at the N-terminus - not included in the family.
    
    There is a PubMed Id connected with several of them relating to vancomycin
    resistance:
    22492855
    

     

    Fig. 1

    sp18390a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     sp18390a.png
    sp18390a
    123.59 kB15:51, 12 Jul 2013qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch