.
The Open Protein Structure Annotation Network
PDB Keyword
.

4m0h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved hypothetical protein, putative anti-sigma factor (BDI_1681) from Parabacteroides distasonis ATCC 8503 at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 4m0h Target Id 416485
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS45718,YP_001303055.1, PF04773 Molecular Weight 26383.53 Da.
    Residues 231 Isoelectric Point 5.60
    Sequence klylnhsakqhtsasdhllteisvnhgehkqvtlpdgtvvhlnagtvmrypteftsdirlvemegeaff nvmrdegkpfivrtrqadvkvlgtsfnvkayqedelmavsvrtgkvevdmpesvmrllpneqiivnntn geilkknedaqkvtawlqgglyfnrtpissvihdlermynqeivldpnvvfddyiygehdnksleavln aiqystgiryrkeesrivlyktsh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.2222
    Matthews' coefficent 2.64 Rfactor 0.1905
    Waters 91 Solvent Content 53.40

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This hypothetical protein, putative anti-sigma factor  from Parabacteroides distasonis ATCC 8503 is the first representation of PF04773 family (FecR protein). The  structure has two domains:  N - terminus has double-stranded beta-helix fold  (corresponding to PF04773) and C-terminus  can be described as  alpha(2)-beta-alpha-beta(2).

    TT6518BC_A.png

    The structure similarity search found this target has a similarity with Tail proteins: 3CDD (the structure alignment below, colored in cyan), 3D37 and 1WRU {PF05954, Phage late control gene D protein (GPD), about 9% seq. id.}

    TT6518BC vs 3CDD whole.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch