.
The Open Protein Structure Annotation Network
PDB Keyword
.

4m0n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved hypothetical protein, putative anti-sigma factor (BDI_1681) from Parabacteroides distasonis ATCC 8503 at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 4m0n Target Id 424925
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS76287,YP_001303055.1, PF04773 Molecular Weight 26383.53 Da.
    Residues 231 Isoelectric Point 5.60
    Sequence klylnhsakqhtsasdhllteisvnhgehkqvtlpdgtvvhlnagtvmrypteftsdirlvemegeaff nvmrdegkpfivrtrqadvkvlgtsfnvkayqedelmavsvrtgkvevdmpesvmrllpneqiivnntn geilkknedaqkvtawlqgglyfnrtpissvihdlermynqeivldpnvvfddyiygehdnksleavln aiqystgiryrkeesrivlyktsh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.2191
    Matthews' coefficent 1.96 Rfactor 0.1822
    Waters 100 Solvent Content 37.38

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Would be the first structure in FecR (PF04773) PFAM family, which is involved in regulation of iron dicitrate transport. In the absence of citrate FecR inactivates FecI. FecR is probably a sensor that recognises iron dicitrate in the periplasm. FFAS and others suggest below the threshold similarity to Anti-Sigma factor ChrR (PDB 2z2s chain B), would be interesting to verify/refute.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch