.
The Open Protein Structure Annotation Network
PDB Keyword
.

4me8

    Title Crystal structure of a signal peptidase I (EF3073) from Enterococcus faecalis V583 at 2.27 A resolution. To be published
    Site JCSG
    PDB Id 4me8 Target Id 389959
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS7642,NP_816685.1, 382891 Molecular Weight 16991.15 Da.
    Residues 150 Isoelectric Point 5.89
    Sequence aavngssmeptlhnndrlwvtsikkpqrfdiiafpsprngqrvakrliglpgetveyrddtlyingvsl sedylasakrnvsknenytqdftletleatqsltvpegmyfvlgdnrprsddsryfgfvkqasvegvlt fryypldkigfp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.27 Rfree 0.2580
    Matthews' coefficent 1.73 Rfactor 0.2124
    Waters 41 Solvent Content 28.92

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    The protein NP_816685.1 is annotated as signal peptidase I. NP_816685.1 belongs to PFAM PF00717 Peptidase_S24.

    The monomer structure is shown below.

    GS13485B.png

     

    Top 10 DALI Structural Homologs
     
    N PDB Z-score RMSD LALI NRES %ID Description
    1 4k8w 11.9 2.0 96 118 25 Lepa
    2 1kn9 9.9 3.1 104 222 37 Signal Peptidase I
    3 3s04 9.8 2.8 103 223 36 Signal Peptidase I
    4 3iiq 9.7 2.7 102 224 36 Signal Peptidase I
    5 1b12 9.6 3.0 104 239 36 Signal Peptidase I
    6 1t7d 9.4 2.6 102 208 36 Signal Peptidase I
    7 3pmt 5.1 2.1 55 55 9 Tudor Domain-containing Protein 3
    8 4hcz 5.0 2.5 55 57 5 Phd Finger Protein 1
    9 3pnw 5.0 2.1 54 54 7 Fab Light Chain
    10 3p8d 5.0 2.0 53 53 13 Medulloblastoma Antigen Mu-mb-50.72

     

    The superposition of NP_816685.1 (green) on 4k8w (magenta) is shown below.

    GS13485B_4k8w.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch