.
The Open Protein Structure Annotation Network
PDB Keyword
.

4me9

    Title Crystal structure of a transcriptional regulator, TetR family (BCE_2991) from Bacillus cereus ATCC 10987 at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 4me9 Target Id 399377
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS29716,NP_979294.1, _0088.001719_, 326431 Molecular Weight 21654.82 Da.
    Residues 188 Isoelectric Point 5.06
    Sequence maknkqedifdaamqlfaergydgttipmiaekakvgagtiyryfenkealvnslfsksmlqlsemikt dfpveanireqfshtynrlfefarnnvdaflftnshcdsyfldeqskkifddfigffmniiedgivkgl lrplppvaliiivyqpleklikviatgqleyskelvkeleesswnairii
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.2430
    Matthews' coefficent 2.96 Rfactor 0.2054
    Waters 88 Solvent Content 58.39

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein NP_979294.1 is annotated as transcriptional regulator, TetR family. NP_979294.1 belongs to PFAM PF00440 TetR_N.

     

    Monomer and crystal packing suggested dimer structures are mshown below.

    MI1030N.png  MI1030N_dimer.png

     

    Top 10 DALI Structural Homologs
     
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 3pas 20.4 3.2 187 192 20 Tetr Family Transcription Regulator
    2 3ppb 19.5 3.8 186 188 19 Putative Tetr Family Transcription Regulator
    3 2gen 18.8 4.1 182 188 20 Probable Transcriptional Regulator
    4 3he0 17.4 4.4 182 186 21 Transcriptional Regulator, Tetr Family
    5 3qkx 17.2 4.2 179 183 22 Uncharacterized Hth-type Transcriptional Regulato
    6 3him 17.2 3.2 183 192 16 Probable Transcriptional Regulator
    7 3col 17.2 2.5 171 180 18 Putative Transcription Regulator
    8 3loc 16.6 3.4 186 201 19 Hth-type Transcriptional Regulator Rutr
    9 1pb6 16.6 3.7 185 198 19 Hypothetical Transcriptional Regulator Ycdc
    10 3on2 16.2 4.6 177 190 15 Probable Transcriptional Regulator

     

    Superposition of NP_979294.1 (green) on 3pas (magenta) is shown below.

    MI1030N_3pas.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch