.
The Open Protein Structure Annotation Network
PDB Keyword
.

4mjf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (BVU_2238) from Bacteroides vulgatus ATCC 8482 at 1.99 A resolution. To be published
    Site JCSG
    PDB Id 4mjf Target Id 385698
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS76145,YP_001299520.1, 332351 Molecular Weight 30925.08 Da.
    Residues 262 Isoelectric Point 4.57
    Sequence dpfetlteeidsltappdtteamaaveeepmvpatadesfadffynfasdeklqlsrivfplpyytmek kehiekdqwkhdplfsrqdaytvlfdkaedmemekdtgltsvkiewiylkkgkikryyferlkglwkle aidfadmpredtgkedffefyerfandsvfqlsrlheplkfvtadpedefqilettleagqwfafqpvl prenltnvnygqnenvhsntkviemkgfgngfnntlyferrhglwklmqfedlsd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.99 Rfree 0.2196
    Matthews' coefficent 2.43 Rfactor 0.1911
    Waters 126 Solvent Content 49.30

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Pfam update (12/10/13): Building from this shows complete overlap with DUF4348 PF14254, so as a structure for a DUF it will be very useful.


    This protein BVU_2238 is a protein of unknown function.

    Fig1.png

    JCSG has also solved another similar structure (50% seq identity, PDB 3sbu) which superimposes on this one with ~1.2A r.m.s.d. and which is referred to as an NTF2-like protein from its structure. Both proteins are the only structural representatives of Pfam PF14254, DUF4348. There are no other significant hits in FFAS. DUF4348 has ~93 proteins, all from Bacteroidetes, and all with a single domain architecture with just one DUF4348 domain.

    There appears a possible gene duplication in the protein as the N-terminal domain (approx residues 25-174, cyan) and C-terminal domain (approx residues 175-286, magenta) superimpose quite well with ~1.9A r.m.s.d. and ~30% sequence identity:

    Fig2_genedup.png

    In this regard with a tandem structural repeat, this protein resembles that of DUF2874 members, for which JCSG has solved structures as well as a manuscript based on the structure of BVU_2987 from the same organism.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     Fig1.png
    No description
    313.29 kB00:28, 7 Aug 2013debanuActions
     Fig2_genedup.png
    No description
    251.79 kB00:36, 7 Aug 2013debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch