.
The Open Protein Structure Annotation Network
PDB Keyword
.

4mjg

    Title Crystal structure of a hypothetical protein (ACTODO_00621) from Actinomyces odontolyticus ATCC 17982 at 2.65 A resolution. To be published
    Site JCSG
    PDB Id 4mjg Target Id 418621
    Molecular Characteristics
    Source Actinomyces odontolyticus atcc 17982
    Alias Ids TPS75212,ZP_02043769.1 Molecular Weight 21309.68 Da.
    Residues 198 Isoelectric Point 4.63
    Sequence aksrdaefvpfpervsieeyisrqlpeissvavpvaaetggeltvmglpyvqvcgtgdtqgyrvvgytt vapsmsferleklvtenkpdwavavqvdkqidrdatrgiqlidnygglvefkfsedsiavrsrsaclpt nkplddpgqfvlpsveeafpgmhvtisdntnpdlhpvptlttgahvtpqsgtqsgtqsgs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.65 Rfree 0.2609
    Matthews' coefficent 3.32 Rfactor 0.2336
    Waters 7 Solvent Content 62.94

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein ZP_02043769.1 is annotated as hypothetical protein ACTODO_00621.

    The target is the first representation of  PF16145, DUF4853 (residues 34-172) with  the external element on C-terminus (residues 173-210). 

     

    The monomer structure is shown below.

    SP17443B.png

    Top DALI Structural Homologs with Z-score > 5
     
    N PDB Z-score RMSD LALI NRES %ID Description
    1 2v7s 8.4 3.3 124 169 15 Probable Conserved Lipoprotein Lppa
    2 1tu1 5.1 3.0 86 144 7 Hypothetical Protein Pa0094

     

    A superposition of ZP_02043769.1 (green) on 2v7s (magenta) is shown below.

    SP17443B_2v7s.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     SP17443B.png
    No description
    70.29 kB18:58, 9 Aug 2013abhinavkActions
     SP17443B_2v7s.png
    No description
    117.06 kB18:58, 9 Aug 2013abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch