.
The Open Protein Structure Annotation Network
PDB Keyword
.

4nw4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (EF0375) from Enterococcus faecalis V583 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 4nw4 Target Id 420207
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS77427,NP_814166.1 Molecular Weight 32550.16 Da.
    Residues 293 Isoelectric Point 6.20
    Sequence dhaanpnsatanlgkhqnngqtrgdkatkilsgtdwqgtrvydaagndltaenanfiglakydgetgfy effdkntgetrgdegtffvtgdgtkrilisrtqnyqavvdltevskdkftykrlgkdklgndvevyveh ipyhgkklaftngrealtnqtgkivtnksgdkilgttlwngtkvvdkngndvtaanqnfislakfdpnt skyeffnlqtgetrgdfgyfqvvdnnkirahvsigtnrygaaleltelnndrftytrmgkdnagndiqv fvehepyqgtyhpaftf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.1815
    Matthews' coefficent 2.67 Rfactor 0.1496
    Waters 272 Solvent Content 53.89

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Shown below is a ribbons representation of the structure of target id 420207

     

    SP18758C_monomer.png

    The target shows a two domain lipocalin fold and will most likely be classified into the new Pfam family PF16103. The structure and sequence are quite similar to another JCSG target PDB ID 4kh8 (http://www.topsan.org/Proteins/JCSG/4kh8

     

    Top hits from FFAS are:

    1 -83.600 4kh8_A mol:protein length:318 hypothetical protein  ali model follow..  59  8 .......DNPNNLGDLPEYLRSVGIRQDEGLSEKDWAGTRVYDRNGNDLTDENQNLLHAIKFDATTSFYEFFDKETGESTGDEGTFFMTTDVSRLVIISETKNYQGVYPLRTLYQDTFTYRQMGKDKNGNDIEVFVENKATSGPVAMTEQTGQIDVNRQGDEIIGKTSFDGTPQLLWNGTKVVDKDGNDVTSANQNFISLAKFDQDSSKYEFFNLQTGETRGDYGYFKVGNQNKFRAHVSIGTNRYGAVLELTELNDNRFTYTRMGKDNEGNDIQVYVEHEPYQGTFNPEFTF 318
    2 -6.500 1oh1_A mol:protein length:109 STAPHOSTATIN A  ali model follow..  13  2 .................................................SMEQFELFSIDKFKCNSEAKYYLNIIEGESTSDDSDYICKNTEHKQLTLYNKNNSSIVIEIFIPNDNKILLTIMNTEALGTSPRMFIKH........................................................................................................................................................... 108
    3 -6.290 2wr8_A mol:protein length:259 PUTATIVE UNCHARACTERIZED PROTEIN PH0463  ali model follow..  10  62 .....................................................KGTVHVGVIDPGVG------TERRAIVIEGDQYLVVPDNGLATLPLKHIKVKSVYEIIPDKIRKFTGWEISSTFHGRDIFGPAGALIEKGIHPEEFGREIPVDSIVKLNVEPRKEGDVWILKV-----YIDDFGNVILNLENYEKPRTVELLDFNLRLPYLETYGLVEKGEMLALPGSHDYLEIAVNMGS.................................................. 241
    4 -5.540 1w8x_N mol:protein length:126 PROTEIN P31  ali model follow..  17  2 .NVNNPNQMTVTPVYNGCDSGEGPQSVRGYFDAVAGENVKYYLADTQGFTGVQCIYIDNAEND---GAFEIDVEETGQPAGKQGYFPLLVPGRAKFVARHLGSGKKSVPLFFLN................................................................................................................................................................................... 118
    5 -5.510 4h5s_B mol:protein length:101 Cell adhesion molecule 1  ali model follow..  1 ........................................MQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDERYFCQLYTDPPQESYTTITVLVPP......................................................................................................................................................... 101
    6 -5.370 1bfi_A mol:protein length:112 P85 ALPHA  ali model follow..  12  7 ..............................HDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVK----HCVINKTATGYGFAEPYNLYSSLKELVL-------YQHTSLVQHNDSLNVTLAY........................................................................................................................................................... 104
    7 -5.310 4jda_A mol:protein length:192 Abscisic acid receptor PYL3  ali model follow..  10  38 ......................................AHRVDAPAHAIWRFVRDFANPNKYKHFIKSCTIRVNGNGIKEIKVGTI-------REVSVVSGLPASTSVELEVLDEEKLSFRVLGGEHRLNNYRSVTSVNEFVVLEKDKKKRVYSVVLESYIVDIPQGNTE........................................................................................................................... 165
    8 -5.290 1u6f_A mol:protein length:139 RNA-binding protein UBP1  ali model follow..  11  11 DPYGQTAQLQQLQQQQQQHIPPTQMNPEPDVLRNLMVNYIPTTVDEVQLRQ-------FERYGPIESVKIVCDRETRQSRG--GFVKFQSGSSAQQAIAGLNGFNILNKRLKVALAASGHQRPGIAGAVGDGNGYL............................................................................................................................................................. 139
    9 -5.280 3c2i_A mol:protein length:97 Methyl-CpG-binding protein 2  ali model follow..  13  31 .....................................................................KLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIMYFEKVGDTSLDPNDFDFTVTGRGSPSR................................................................................................................................................................... 91
    10 -5.260 3vyq_A mol:protein length:74 Methyl-CpG-binding domain protein 4  ali model follow..  19  18 .....................................................................VVKQRLSGKTAGKFDVYFISPQGLKFRSKRSLANYLLKNGETFLKPEDFNFT............................................................................................................................................................................ 69

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     SP18758C_monomer.png
    No description
    137.31 kB21:52, 11 Oct 2013haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch