.
The Open Protein Structure Annotation Network
PDB Keyword
.

4obi

    Title Crystal structure of a hypothetical protein (EF3258) from Enterococcus faecalis V583 at 1.73 A resolution. To be published
    Site JCSG
    PDB Id 4obi Target Id 420183
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS83147,NP_816855.1 Molecular Weight 11790.64 Da.
    Residues 105 Isoelectric Point 5.09
    Sequence mqnrgqeaatyqavlkvdnkvikvfdlkkdgphytykyeakdgdynlievdgdrirvkeancadlvdvr rgwiskpgetpiaclphnlfitveasdgsedgsliy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.73 Rfree 0.1992
    Matthews' coefficent 2.02 Rfactor 0.1690
    Waters 79 Solvent Content 39.07

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein NP_816855.1 is annotated as hypothetical protein EF3258. NP_816855.1 belongs to PFAM PF07009 DUF1312. This consists of several bacterial proteins of around 120 residues in length. The function of this family is unknown.

     

    The monomer structure is shown below.

    TB1554C.png

    A zinc atom is bound to the structure as showb below.

    zn.png

     

    Top 10 DALI Structural Homologs
     
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 3ld7 16.7 1.2 86 87 38 Lin0431 Protein
    2 4esn 13.9 1.4 77 78 29 Hypothetical Protein
    3 2kpp 13.0 1.4 85 114 39 Lin0431 Protein
    4 1npp 13.0 1.5 80 238 19 Transcription Antitermination Protein Nusg
    5 1m1g 13.0 1.5 80 239 19 Transcription Antitermination Protein Nusg
    6 1m1h 12.9 1.6 80 182 19 Transcription Antitermination Protein Nusg
    7 1npr 12.0 1.5 79 242 19 Transcription Antitermination Protein Nusg
    8 3uv0 5.5 2.9 77 99 5 Mutator 2, Isoform B
    9 3po8 5.5 2.9 76 98 9 Putative Uncharacterized Protein Tb39.8
    10 3poa 5.2 2.8 74 96 9 Putative Uncharacterized Protein Tb39.8


    A superposition of NP_816855.1 (green) on 3ld7 (orange) is shown below.

    TB1554C_3ld7.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch