.
The Open Protein Structure Annotation Network
PDB Keyword
.

4oh1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative zinc-binding dehydrogenase (gutB) from Clostridium scindens ATCC 35704 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 4oh1 Target Id 429181
    Molecular Characteristics
    Source Clostridium scindens atcc 35704
    Alias Ids TPS78305,ZP_02430688, 205, _0052.006031_, _0119.001924_, 3.40.640.10 Molecular Weight 38579.44 Da.
    Residues 350 Isoelectric Point 5.33
    Sequence mrqlfvtsirdfekntmgtvdmmeapmpepkdeeirikvvyasicgsdthiltgnlgemesttrsmlpm sfghelsgvidkvgstaekmgfkvgqkvvanyakycgccencregkvnlcsnmgyrmngfseyavyhms qifpipddadlkdyalvepltvalssaeqakisygksvaimgagglgmmlvqlarlagastitvfdivp eklelalengadyalnsaeegvaeraielaggrydcvlegtgataaaklglqllardgdavyfamygkd pilpvnlqsdlywdqkhihgmiqgawqfpksirmiprmdfskiiqkehtltnykqafedlyskkyakiv ikmde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2159
    Matthews' coefficent 2.57 Rfactor 0.1682
    Waters 193 Solvent Content 52.11

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch