.
The Open Protein Structure Annotation Network
PDB Keyword
.

4onz

    Title Crystal structure of a putative glycoside hydrolase (BACOVA_02161) from Bacteroides ovatus ATCC 8483 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 4onz Target Id 419052
    Molecular Characteristics
    Source Bacteroides ovatus atcc 8483
    Alias Ids TPS82711,ZP_02065187.1 Molecular Weight 40438.95 Da.
    Residues 358 Isoelectric Point 8.46
    Sequence ldtnqekqdnnwvigpflrpegvnpvispqptefycpmrkqqvkweesdtfnpaatvkdgkivvlyrae dnsaqgigkrtsrvgyaeskdgiemkrldnpvlfpaednfkdqdwpggcedprvamtedglyvmlytaw nrkkarlavatsrdlknwtkhglafdkayngrfnnlfcksgsiltklkgnqlvidkvngkyfmywgeha iyaatsdnlidwypvldeknelmkiiqprkghfdslltecgppairtkhgivlvyngknsgktgdanyp gnaycagqllldgndpykvldrldkpffapeapfeksgqykdgtvfieglvyhkkklylyygcadsqva vavcddvkklktk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.2014
    Matthews' coefficent 2.09 Rfactor 0.1562
    Waters 269 Solvent Content 41.25

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein ZP_02065187.1 is annotated as hypothetical protein BACOVA_02161. ZP_02065187.1 belongs to PFAM PF04041 DUF377. This consists of many hypothetical proteins, some of which are predicted to be glycosyl hydrolases. This family was noted to belong to the Beta fructosidase superfamily.

     

    The monomer structure consists of five three-stranded sheets arranged in a pentameric configuration.

    SP1225B.png

    On the basis of a homologous structure 3TAW (in orange), an unknown ligand has been modeled into the putative active site of this protein (green), as shown below. The unknown ligands are shown as spheres.

    SP1225B_3TAW_UNL.png

    Top 10 SSM Structural Homologs
     
    N PDB Q-score RMSD Nalgn Nres-T %seq Description (JCSG structures highlighted in red)
    1 3r67 0.8893 0.755 335 348 65.4 a Putative Glycosidase (bt_4094) from Bacteroides Thetaiotaomicron Vpi-5482 at 2.30 A Resolution
    2 3qc2 0.8717 0.662 335 360 62.7 a Glycosyl Hydrolase (bacova_03624) from Bacteroides Ovatus at 2.30 A Resolution
    3 3taw 0.8592 0.905 334 349 66.2 a Hypothetical Glycoside Hydrolase (bdi_3141) from Parabacteroides Distasonis ATCC 8503 at 1.70 A Resolution

     

    A superposition of ZP_02065187.1  (green) on 3r67 (magenta) is shown below.

    SP1225B_3r67.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch