.
The Open Protein Structure Annotation Network
PDB Keyword
.

4orl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (BACOVA_04304) from Bacteroides ovatus ATCC 8483 at 1.40 A resolution. To be published
    Site JCSG
    PDB Id 4orl Target Id 416956
    Molecular Characteristics
    Source Bacteroides ovatus atcc 8483
    Alias Ids TPS76803,ZP_02067300.1, 328310 Molecular Weight 12299.41 Da.
    Residues 109 Isoelectric Point 9.81
    Sequence qeipagvitafkrgssqelskymgdkvnlvfqgrstnvdkqkataamqefftknkvsgfnvnhqgkrde ssfvigtlattngnfrvncflkkvqnqylihqiridkine
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.2085
    Matthews' coefficent 2.13 Rfactor 0.1819
    Waters 124 Solvent Content 42.29

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    This target is in the same new PFam DUF family DUF4783, PF16022  as another recently solved homolog, JCSG id SP13297E/Target id 418300.

    See TOPSAN page for SP13297E/Target id 418300.Fig1.png

     

    FFAS hits:

     

    # Score Template Links and tools %id First QEIPAGVITAFKRGSSQELSKYMGDKVNLVFQGRSTNVDKQKATAAMQEFFTKNKVSGFNVNHQGKRDESSFVIGTLATTNGNFRVNCFLKKVQNQYLIHQIRIDKINE Last
    1 -11.900 3f14_A mol:protein length:112 uncharacterized NTF2-like protein  ali model follow..  3 ETTHYSIAQHFSSGDFPAVYACFNDIIEWNIIGNQVVKGKADVIDFCNKMLPEMKGAVLTNDNVIQNENQIVIEGKCRYFDAE.......................... 85
    2 -11.200 2rcd_A mol:protein length:129 Uncharacterized protein  ali model follow..  11  17 TAAFYRYEKALTGNDVAVLDELFWHDEKTVRYGAGENLYGIEE---IRAFRLARALRNTVITTYGHDMAVASTEFTRTGSTKIGRQMQTWVKMPEGWRIVAAHVSLMSE 129
    3 -11.100 1nu3_A mol:protein length:149 limonene-1,2-epoxide hydrolase  ali model follow..  25 EKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSIDAVETFHIGSSNGLVYTVLRALPTGKSYNLSIL-----GVFQLTEGKITGWRD 132
    4 -11.000 3f7x_A mol:protein length:151 Putative polyketide cyclase  ali model follow..  11  17 TELVNAYYAAFNAGDMPAFLALLSEDVIHDINQGERQMGKARFAAFMEKMNRCYRERLADIVVMQNADGSRAAAEFTVHGQYLADDEGLPTANGQTYVLPAGAFFYIHC 125
    5 -9.700 3en8_A mol:protein length:128 uncharacterized NTF-2 like protein  ali model follow..  8 REALNAHWQASAAGDFDAEHDIYDDDAICDYPQSGERILGRMN---LQALRSHHPGKPAGFEVRRIQGEGNLWITEYSISYNGRPAYTV-----SIMEFRNGKVVHETQ 108
    6 -9.420 3gwr_A mol:protein length:144 Putative calcium/calmodulin-dependent protein  ali model follow..  11 EAAEDAFYAAFEARSLDDMMAVWARDDHVACIHPLAA-GRAAVAAGWRSMFGAAGRFRLQVKAVHEIRQADHVIRI-TAPRPAILATNVYRREADGWRM.......... 120
    7 -9.340 3i0y_A mol:protein length:140 Putative polyketide cyclase  ali model follow..  11 TGLVQAYYEAFNRGDWDAMLAFLAEDVAHDLNQGPREIGRAAFASFLQRMNDSYREQLRDIVVTANDEGTRVGAEYVVHGVYHTTDEGLPDANGQTYVLPGGAFFDVRD 119
    8 -9.250 2gxf_A mol:protein length:142 Hypothetical protein yybH  ali model follow..  13  6 KDIISACDLAIQNEDFDTLMNYYSEDAVLVVKPGMIARGKEEIKKAFITIANYFNHHTQGKMILLEAGDTVLVLSQTLLDSDK-ATYVFKKNAQGEWLC.......... 116
    9 -9.170 3lyg_A mol:protein length:120 NTF2-like protein of unknown function  ali model follow..  10  5 ANIVQRGWEALGAGDFDTLVTDYVEKMIFIMPGQADVLKGRQAFRSALDNLGEILPPGFEITGLRQLEGENEIVSIVEWKSDK.......................... 87
    10 -9.100 3dm8_A mol:protein length:143 uncharacterized protein RPA4348  ali model follow..  7 WRFSRALHRALNDRQTEELATIIDDNIDWAIYGPIDMFGKAAVLEVCRQIADSVRIYRYHRESVMLGIDSAASMVRYSLT---------AAGTNRPISVRMALFTQFQN 113
    11 -9.100 3hx8_A mol:protein length:129 putative ketosteroid isomerase  ali model follow..  9 EAANADFVKAYNSKDAAGVASKYMDDAAAFPPDMARVDGRQNIQKLWQGAMDMGISEKLTTLDVQESGDFAFESGSFSVDAAGKYVVVWRKGQDGGWKL.......... 118

     

    It is likely an NTF2-like protein since they share similar folds.

    See recent publication about NTF-2 protein domain families.[Ref]

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    193.21 kB01:23, 9 Feb 2013debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch