.
The Open Protein Structure Annotation Network
PDB Keyword
.

4ouq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (BF1468) from Bacteroides fragilis YCH46 at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 4ouq Target Id 418300
    Molecular Characteristics
    Source Bacteroides fragilis ych46
    Alias Ids TPS73664,YP_098753.1, 326684 Molecular Weight 12282.18 Da.
    Residues 109 Isoelectric Point 9.51
    Sequence qdipvgvvvafkkgnsqelnrylgekvnlviqnrsesvdrqaaegtlaaffssnkvsgfnvnhegkrde ssfiigtlttangnfrincffrrvqnkylinqiridktne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.2391
    Matthews' coefficent 1.95 Rfactor 0.1990
    Waters 105 Solvent Content 36.96

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Pfam update (based on structure of close homolog, JCSG target SP13297B, which has 60% seq id over entire protein to this one, SP13297E):

    Built into a new DUF: DUF4783, PF16022
    Just below threshold there was a hit to B0S1Z8.1 in PF10543, family ORF6N. The
    only reference for this family is one by Aravind's group: PubMed: 11897024
    This implies the sequence might be a transcription regulator of DNA viruses.

     

    B0S1Z8.1 is a KilA-N terminal DNA-binding domain protein.

    Fig1.png

    FFAS hits:

     

    # Score Template Links and tools %id First QDIPVGVVVAFKKGNSQELNRYLGEKVNLVIQNRSESVDRQAAEGTLAAFFSSNKVSGFNVNHEGKRDESSFIIGTLTTANGNFRINCFFRRVQNKYLINQIRIDKTNE Last
    1 -11.800 3f14_A mol:protein length:112 uncharacterized NTF2-like protein  ali model follow..  3 ETTHYSIAQHFSSGDFPAVYACFNDIIEWNIIGNQVVKGKADVIDFCNKMLPEMKGAVLTNDNVIQNENQIVIEGKCRYFDAE.......................... 85
    2 -11.200 2rcd_A mol:protein length:129 Uncharacterized protein  ali model follow..  11  17 TAAFYRYEKALTGNDVAVLDELFWHDEKTVRYGAGENLYGIEE---IRAFRLARALRNTVITTYGHDMAVASTEFTRTGSTKIGRQMQTWVKMPEGWRIVAAHVSLMSE 129
    3 -11.100 1nu3_A mol:protein length:149 limonene-1,2-epoxide hydrolase  ali model follow..  13  25 EKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSIDAVETFHIGSSNGLVYTVLRALPTGKSYNLSIL-----GVFQLTEGKITGWRD 132
    4 -11.000 3f7x_A mol:protein length:151 Putative polyketide cyclase  ali model follow..  17 TELVNAYYAAFNAGDMPAFLALLSEDVIHDINQGERQMGKARFAAFMEKMNRCYRERLADIVVMQNADGSRAAAEFTVHGQYLADDEGLPTANGQTYVLPAGAFFYIHC 125
    5 -9.700 3en8_A mol:protein length:128 uncharacterized NTF-2 like protein  ali model follow..  8 REALNAHWQASAAGDFDAEHDIYDDDAICDYPQSGERILGRMN---LQALRSHHPGKPAGFEVRRIQGEGNLWITEYSISYNGRPAYTV-----SIMEFRNGKVVHETQ 108

     

    They are likely NTF-2 like proteins, which have diverse sequences.

    See latest paper about NTF-2 like proteins by Eberhardt et al. [Ref].

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    205.96 kB00:59, 8 Feb 2013debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch