.
The Open Protein Structure Annotation Network
PDB Keyword
.

4ppy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative acylhydrolase (BF3764) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 4ppy Target Id 419039
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS83111,YP_213353.1, BIG_215 Molecular Weight 23238.01 Da.
    Residues 209 Isoelectric Point 8.69
    Sequence qekdwanlqryaqqnaelpkpdknekrvvfmgnsitegwvnthpdffksngyigrgiggqtsyqflvrf redvinlspalvvinaatndiaentgayhedrtfgnivsmvelakanhikviltttlpaaafgwnpsik dapqkiaslnarlkayaqtnkipfvdyyssmvsgsnkalnpaytkdgvhptsegydvmenliqqainktlr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.2075
    Matthews' coefficent 2.71 Rfactor 0.1850
    Waters 508 Solvent Content 54.66

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Pfam update: From the HMMER output it would seem to match Lipase_GDSL_2 for which there are several structures: http://hmmer.janelia.org/results/5786DC1C-995A-11E3-9B64-56FB58DEE9FE/domain


    This target is annotated as a putative acylhydrolase belonging to Pfam family PF00657 (Lipase_GDSL). This protein has ~76% over ~90% of the protein to another JCSG target, PDB 4hf7 and lesser id to 2 other JCSG structures, PDB ids 4iyj and 3p94.

    Fig1.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    299.48 kB19:39, 13 Nov 2013debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch