.
The Open Protein Structure Annotation Network
PDB Keyword
.

4ps6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an inhibitor of vertebrate lysozyme (PA3902) from Pseudomonas aeruginosa PAO1 at 1.25 A resolution. To be published
    Site JCSG
    PDB Id 4ps6 Target Id 420291
    Molecular Characteristics
    Source Pseudomonas aeruginosa pao1
    Alias Ids TPS83149,NP_252591.1 Molecular Weight 14461.47 Da.
    Residues 129 Isoelectric Point 5.69
    Sequence eeqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansckphdcgnnrl lvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellmkqlesdpnwk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.25 Rfree 0.1639
    Matthews' coefficent 1.94 Rfactor 0.1161
    Waters 309 Solvent Content 36.51

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    This protein is 100% identical to solved structure 1uuz.pdb, which belongs to the Pfam IVY family.

     

    See reference:[Ref].

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch