.
The Open Protein Structure Annotation Network
PDB Keyword
.

4q1z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein (BT1938) from Bacteroides thetaiotaomicron VPI-5482 at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 4q1z Target Id 392884
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS29495,NP_810851.1, 384235 Molecular Weight 44384.11 Da.
    Residues 399 Isoelectric Point 4.52
    Sequence msgtaevnpitvdvylditvenistlkdltvkfdnydedlhyvkevtdnsvkvdgiipgiysvtvsgta idtenneyyingnsvnaalfkhgsalnievqglkvsplifkeiyycgsrpekggvyfrdqfyeiynnsa dilyldgiyfanltpgtattklpiwpeadgnnyaygervwkfpgngteyplapgesciisqfaanhqld iynpqspidgsssefefnmnnpnfpdqaaydmqhvfyqgkaemgsipqyltsvfggayvifrvpegeaw dpvndenmkttdlskpnsnvyyakipikyvldaveavnneskmnakrvpgvldagitwvgatycglgia rklstdeegnpiireetgtyiyqdtnnstddfergvvpvmrrngakmpswnhtl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.2096
    Matthews' coefficent 3.26 Rfactor 0.1791
    Waters 151 Solvent Content 62.33

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Pfam update: Built as DUF4876, PF16215. The members are proposed lipoproteins. In two cases the duf is associated with the BACON domain - Bacteroidetes-Associated Carbohydrate-binding Often N-terminal.

    This protein, BT_1938, is a putative lipoprotein. The structure reveals a 2 domain protein:

    Fig1.png

    This structure is the first reperestnation of PF16215 family (DUF4876).  Structure similarity search for each domain by FATCAT  and DALI found that N- terminus domain has Ig- beta-sandwich fold, and C- terminus domain has a lamin- like fold with many loops. 

    A structural superposition of N-terminus domain (blue) with 1oww (cyan), which  has a human fibronectin type III domain, is shown below.  A structural  superposition of  C-terminus domain (dark pink) and  the top Dali hit- 3gef (gold), which is human lamin A/C ( Dali Z- score  7.3, rmsd 2.2, 10% seq. id). 

     

    pair_FR15002A_N_term_1owwa.png3gefa.FR15002A_cterminus.png

     

     

    Genomic content  shows that this protein expressed in the operon next to SusC-like protein (which has ~100 residues short length than “classic” SusC) 

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch