.
The Open Protein Structure Annotation Network
PDB Keyword
.

4q6k

    Title Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 4q6k Target Id 419275
    Molecular Characteristics
    Source Bacteroides caccae atcc 43185
    Alias Ids TPS83612,ZP_01959484.1, 228 Molecular Weight 57839.76 Da.
    Residues 524 Isoelectric Point 8.29
    Sequence vtsdtvfvretqipilierqdnvlfmlrlnakesrsldevvlnfgkdvnmadiqsvklyysgtearqny gkkfftpvsyisshtpgktlaanpsysinksqvnnpgrkvilnanqklfpginyfwislqmkpgaslld kvsakivtvkvdnkealmhtvspeniahrvgvgvrhagddgsaafripglattnkgtllgvydvrynss vdlqehvdvglsrsvdggktwekmrlplafgetgglpaaqngvgdpsilvdtktnttwvvaawthgmgn qrawwssypgmdmnhtaqlvlskstddgktwsepinitdqvkdpswyfllqgpgrgitmqdgtlvfpiq fidstrvpnagimyskdrgetwkihnyartntteaqvaevepgvlmlnmrdnrggsravattkdlgktw tehpssrkalqepvcmaslisvkaadntlnkdillfsnpntvkgrhhitikasldggitwlpehqvmld egdgwgyscltmidketvgilyessvahmtfqairlrdiiq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.1729
    Matthews' coefficent 2.73 Rfactor 0.1377
    Waters 2194 Solvent Content 54.99

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein ZP_01959484.1 is annotated as hypothetical protein BACCAC_01090. ZP_01959484.1 belongs to PFAM PF14873. This domain is usually found at the N-terminus of the BNR-repeat neuraminidase protein family.

     

    The monomer structure is shown in a rainbow representation below.

    SP16569C.png

    Top 10 DALI Structural Homologs
     
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 4fj6 67.7 1.0 519 520 70 Glycoside Hydrolase Family 33, Candidate Sialidas
    2 1w8n 48.5 1.8 339 601 30 Bacterial Sialidase
    3 2bzd 48.1 1.8 339 601 30 Bacterial Sialidase
    4 2bq9 48.1 1.8 339 601 30 Bacterial Sialidase
    5 1wcq 48.1 1.8 339 599 30 Sialidase
    6 2bf6 48.0 1.8 338 448 31 Exo-alpha-sialidase
    7 2vk7 47.9 1.8 338 448 31 Exo-alpha-sialidase
    8 2vk6 47.9 1.8 338 448 31 Exo-alpha-sialidase
    9 2ber 47.9 1.8 339 601 30 Bacterial Sialidase
    10 1w8o 47.9 1.8 339 601 30 Bacterial Sialidase

     

    A  superposition of ZP_01959484.1 (green) on 4fj6 (magenta) is shown below.
    SP16569C_4fj6.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     SP16569C.png
    No description
    113.4 kB22:54, 26 Feb 2014abhinavkActions
     SP16569C_4fj6.png
    No description
    157.92 kB22:54, 26 Feb 2014abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch