.
The Open Protein Structure Annotation Network
PDB Keyword
.

4q98

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a fimbrilin (fimA) from Porphyromonas gingivalis W83 at 1.30 A resolution (PSI Community Target, Nakayama). To be published
    Site JCSG
    PDB Id 4q98 Target Id 424993
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS83666,NP_906188.1, 164 Molecular Weight 39089.60 Da.
    Residues 368 Isoelectric Point 4.97
    Sequence kdneaepvvetnatvsfiiksgesravgddltdakitkltamvyagqvqegiktveedggvlkvegipc ksganrvlvvvanhnyeltgkslnevealttsltaenqnaknlimtgksaaftikpgsnhygypggtas dnlvsagtplavtrvhagisfagvevnmatqyqnyysfkpadakiaalvakkdskifgnslvsntnayl ygvqtpaglytpdaagetyeleaslntnyavgagfyvleskydasnelrptilciygklldkdgnplte paltdainagfcdgdgttyypvlvnydgngyiysgaitqgqnkivrnnhykislnitgpgtntpenpqp vqanlnvtcqvtpwvvvnqaatw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.1561
    Matthews' coefficent 2.05 Rfactor 0.1186
    Waters 619 Solvent Content 40.09

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Structure of a major fimbrilin. Community target. Structural analysis will be presented later with collaborators.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch