.
The Open Protein Structure Annotation Network
PDB Keyword
.

4qfu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a glycoside hydrolase family 5 (BVU_2644) from Bacteroides vulgatus ATCC 8482 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 4qfu Target Id 385740
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS76149,YP_001299918.1, 332340 Molecular Weight 53754.64 Da.
    Residues 465 Isoelectric Point 5.99
    Sequence aktyipwkngklvvseegrylkhengvpffwlgetgwlmpqrlnrdevsyylnkckdagynmvqvqvln gvpsmniygqysmtdgfnfkdinrkgiygywdhmdyiiksaasrgiyigmvciwgtpveqglmnekeav aygkflaerykdepniiwmiggdirgdnktevwdalansirsidkghlmtfhprgrttsatwfndrewl dfnmfqsghrrygqrngdgdypieenteednwrfveasqaktplkpviddepiyedipqglhdpnetrw nqhdvrryaywsvfagsfghsyghndimqfirpgygasfgadgrkkawwdaledpgfnqmkylknlmlt fpffervpdqsviagtngerydraiatrgndyllvynysgrpmqidlskisgakknawwysakdgkley igefdskvtsfqhdsgylsgndqvlivvdsakdyvqkawtalpdaiqkwnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 1.90 Rfree 0.1716
    Matthews' coefficent 2.47 Rfactor 0.1422
    Waters 5324 Solvent Content 50.18

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    homolog to 3kzs. Both proteins were solved by JCSG.

     

    4QFU            ------AKTYIPWKNGKLVVSEEGRYLKHENGVPFFWLGETGWLMPQRLNRDEVSYYLNK
    3KZS            GAQKKTQKTYIPWSNGKLVVSEEGRYLKHENGTPFFWLGETGWLLPERLNRDEAEYYLEQ
                           ******.******************.***********:*:******..***::
    
    4QFU            CKDAGYNMVQVQVLNGVPSMNIYGQYSMTDGFNFKDINRKGIYGYWDHMDYIIKSAASRG
    3KZS            CKRRGYNVIQVQTLNNVPSMNIYGQYSMTDGYNFKNINQKGVYGYWDHMDYIIRTAAKKG
                    **  ***::***.**.***************:***:**:**:***********::**.:*
    
    4QFU            IYIGMVCIWGTPVEQGLMNEKEAVAYGKFLAERYKDEPNIIWMIGGDIRGDNKTEVWDAL
    3KZS            LYIGMVCIWGSPVSHGEMNVDQAKAYGKFLAERYKDEPNIIWFIGGDIRGDVKTAEWEAL
                    :*********:**.:* ** .:* ******************:******** **  *:**
    
    4QFU            ANSIRSIDKGHLMTFHPRGRTTSATWFNDREWLDFNMFQSGHRRYGQRNGDGDYPIEENT
    3KZS            ATSIKAIDKNHLMTFHPRGRTTSATWFNNAPWLDFNMFQSGHRRYGQRFGDGDYPIEENT
                    *.**::***.******************:  ***************** ***********
    
    4QFU            EEDNWRFVEASQAKTPLKPVIDDEPIYEDIPQGLHDPNETRWNQHDVRRYAYWSVFAGSF
    3KZS            EEDNWRFVERSMAMKPMKPVIDGEPIYEEIPHGLHDENELLWKDYDVRRYAYWSVFAGSF
                    ********* * * .*:*****.*****:**:**** **  *:::***************
    
    4QFU            GHSYGHNDIMQFIRPGYGASFGADGRKKAWWDALEDPGFNQMKYLKNLMLTFPFFERVPD
    3KZS            GHTYGHNSIMQFIKPGVGG---AYGAKKPWYDALNDPGYNQMKYLKNLMLTFPFFERVPD
                    **:****.*****:** *.   * * **.*:***:***:*********************
    
    4QFU            QSVIAGTNGERYDRAIATRGNDYLLVYNYSGRPMQIDLSKISGAKKNAWWYSAKDGKLEY
    3KZS            QSVIAGQNGERYDRAIATRGNDYLMVYNYTGRPMEVDFSKISGAKKNAWWYTTKDGKLEY
                    ****** *****************:****:****::*:*************::*******
    
    4QFU            IGEFDSKVTSFQHDSGYLSGNDQVLIVVDSAKDYVQKAWTALPDAIQKWNK
    3KZS            IGEFDNGVHKFQHDSGYSSGNDHVLIVVDSSKDYVKKDCYQIDTHE-----
                    *****. * .******* ****:*******:****:*    :         
    

     

    The N-terminal contains DUF4038 (PF13204).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch