.
The Open Protein Structure Annotation Network
PDB Keyword
.

4qjr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The signaling phospholipid PIP3 creates a new interaction surface on the nuclear receptor SF-1. Proc.Natl.Acad.Sci.USA 111 15054-15059 2014
    Site JCSG
    PDB Id 4qjr Target Id 429246
    Related PDB Ids 4qk4 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS82201,NM_004959 Molecular Weight 27847.04 Da.
    Residues 244 Isoelectric Point 5.61
    Sequence sggpnvpelilqllqlepdedqvrarilgclqeptksrpdqpaafgllcrmadqtfisivdwarrcmvf kelevadqmtllqncwsellvfdhiyrqvqhgkegsillvtgqevelttvatqagsllhslvlraqelv lqllalqldrqefvclkfiilfsldlkflnnhilvkdaqekanaalldytlchyphcgdkfqqlllclv evralsmqakeylyhkhlgnemprnnlliemlqakqt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.2296
    Matthews' coefficent 3.32 Rfactor 0.1895
    Waters 117 Solvent Content 62.98

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Crystal structure of ternary complex of the LBD of SF-1 in complex with regulating peptide from PPARGC1a and signaling lipid PIP3. Manuscript is in preparation of this complex and another on of the ternary complex with PIP2.

    PSI Biology project of the Partnership for Stem Cell Biology with the Fletterick and Ingraham labs at UCSF.

    Fig1.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    305.95 kB18:14, 22 May 2014debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch